Weight LossMen's HealthWomen's HealthHow It WorksPricing
Sign In
Start Free Assessment

This program is launching soon. Join our waitlist for priority access and to be notified the moment enrollment opens.

Testosterone Replacement Therapy — Coming Soon

Your Energy. Your Drive.
Your Strength. Restored.

Clinician-prescribed testosterone cypionate with in-person labs included, quarterly provider monitoring, and ongoing oversight — anticipated at $169/month. Launching soon.

How It Works →
[Photo: Confident athletic man, early 40s, natural smile, modern home, natural lighting]
From $169/mo
Labs included
35
States planned
Quest & Labcorp
Labs drawn nationwide
24–48h
Provider review
Licensed Physicians in 35 States
In-Person Labs Included
Quarterly Provider Monitoring
FSA/HSA Accepted
Cancel Anytime
Is This You

Is Low Testosterone
Affecting Your Life?

Testosterone declines naturally starting around age 30 — roughly 1 to 2 percent per year. By your mid-40s levels may have dropped enough to cause real symptoms even if your annual bloodwork shows you within the so-called normal range. Normal is not the same as optimal.

Persistent fatigue that a full night of sleep does not fix
Difficulty building or maintaining muscle despite consistent training
Increased body fat especially around the midsection
Low motivation or drive at work and in your personal life
Reduced libido or noticeable changes in sexual function
Brain fog or difficulty staying focused and mentally sharp
Mood changes including irritability or a persistent low mood
Longer recovery time after physical activity
These symptoms overlap with many conditions. A licensed provider reviews your complete health history to determine whether testosterone therapy is appropriate for you.
[Photo: Man, mid-40s, sitting at desk, thoughtful expression, warm natural office lighting]
The Science, Made Simple

How Testosterone Replacement
Therapy Works

Testosterone is produced primarily in the testes in response to luteinizing hormone from the pituitary gland. As the hormonal signaling chain between the hypothalamus, pituitary, and testes becomes less responsive with age, testosterone production declines. TRT introduces clinician-prescribed testosterone cypionate — an esterified form of testosterone with a gradual release window — to restore circulating testosterone to a physiologically optimal range. Effects on energy, muscle mass, fat distribution, mood, libido, and cognitive function typically develop over 8 to 16 weeks as the body adjusts to restored hormone levels.

In plain English: Think of testosterone as the dial that controls energy, strength, and drive. TRT does not create a superhuman — it restores the baseline that your biology gradually took away. Most patients describe feeling like themselves again rather than feeling different. The goal is optimal, not excessive.

What to Expect and When

Weeks 1–2Injection or application begins. Energy changes are subtle. Some patients notice improved sleep quality first.
Weeks 4–6Most patients notice improved energy and mood. Morning motivation begins returning.
Weeks 8–12Libido, strength, and body composition changes become more noticeable. Training recovery improves.
Week 12 and beyondFull effects on muscle mass, fat distribution, and mental clarity. Quarterly lab review confirms levels in optimal range.
Month 6 and beyondOngoing maintenance. Dose adjustments made based on labs and how you feel.
Delivery Options

Three Ways to Take Testosterone
Clinician Recommended.

Your provider recommends the formulation that best fits your lifestyle, preferences, and clinical profile. All options include the same labs and monitoring at the same price.

[Photo: Clean medical vial, clinical white background, minimal]
Most Prescribed

Injectable (Testosterone Cypionate)

Weekly or biweekly subcutaneous injection into the abdomen or thigh. Highest bioavailability. Consistent testosterone levels throughout the week.

[Photo: Topical gel tube, clean minimal product photography]
No Needles

Topical Gel

Daily application to shoulders, upper arms, or abdomen. Steady daily absorption. Good option for patients who prefer not to inject. Important: avoid skin-to-skin contact with others for several hours after applying.

[Photo: Small tablet, clean minimal photography]
Once Daily

Oral Tablet

Once daily oral formulation. Convenient for patients who prefer not to inject or apply topicals.

Your prescribing clinician determines the appropriate formulation, dose, and delivery method based on your health history and labs. Not all formulations are available in all states.

Full Transparency

What Labs Are Required
— And Why We Require Them

We believe you should understand exactly what we are testing and why. Labs are not a hurdle — they are how we keep your protocol safe and effective.

Initial Labs Before First Prescription — One-Time $50 Fee at Quest or Labcorp
Total TestosteroneEstablishes your baseline and confirms clinical need.
Free TestosteroneMeasures the active fraction available to your tissues — often more telling than total T alone.
EstradiolTestosterone converts to estrogen — monitoring prevents excess conversion.
Complete Blood CountMonitors red blood cell levels — TRT can raise hematocrit over time.
Comprehensive Metabolic PanelKidney and liver health baseline.
PSA (men 40 and older)Standard safety screening before starting TRT.
Lipid PanelCardiovascular health baseline.
Ongoing Labs Included in Monthly Price — Quarterly
Testosterone Total and FreeConfirms dose is achieving target range.
EstradiolMonitors conversion — may indicate need for anastrozole.
Complete Blood CountHematocrit monitoring for long-term safety.
AnnualFull panel repeat.
Labs drawn in-person at Quest or Labcorp nationwide. Provider sends order electronically. No appointment needed at most locations. Results upload directly to your patient portal.
Optional Add-On

Protecting Testicular Function
During TRT

When you start testosterone therapy your body’s own production naturally slows because it detects the external supply. For men who want to preserve testicular size, maintain natural production capacity, or protect fertility options during TRT, Gonadorelin may be appropriate.

What Gonadorelin is: A clinician-prescribed peptide that signals the pituitary gland to continue releasing the hormones that keep the testes active during TRT. It works alongside your testosterone protocol — not instead of it.

Men under 45 who want to preserve fertility options
Men concerned about testicular size changes during TRT
Men who plan to eventually stop TRT and want easier recovery
Men who notice changes after starting TRT

Add-on price: $35/month added to existing TRT subscription. Available only as an add-on — not standalone.

Bring this up with your provider during intake. If it makes clinical sense they will add it to your prescription. You do not need to decide before starting.
Hormone Balance

Managing Estrogen During TRT

Testosterone naturally converts to estrogen through a process called aromatization. For most men on TRT this stays within a healthy range. Some patients — particularly those with higher body fat — convert more, which can cause water retention, mood changes, reduced libido, or breast tissue sensitivity. If your labs show elevated estradiol your provider may include anastrozole in your formulation — a compound that reduces testosterone-to-estrogen conversion. No additional charge.

Availability

States Where TRT
Is Coming Soon

Testosterone cypionate is a Schedule III controlled substance. Our clinical partner network is preparing to launch TRT in these 35 states. If your state is not listed, Enclomiphene — our non-steroid alternative, also coming soon in all 50 states — may be right for you.

AKAZCACODCFLIAIDILINKSKYMDMEMAMIMSMTNENVNHNJNMNYOHORSDTNTXUTVTVAWAWVWI
Not in a covered state? See Enclomiphene →
Full Transparency

TRT Pricing — Everything Included

One price covers your medication, labs at Quest or Labcorp, provider visits, and quarterly monitoring. The only additional charge is the one-time initial lab fee. Pricing shown reflects anticipated launch pricing and is subject to change before enrollment opens.

$169
/month · flexible
Labs included · billed every 4 weeks
$149
/month · 12-week plan
$447 charged upfront · saves ~12% vs monthly
$129
/month · 24-week plan
$774 charged upfront · saves ~24% vs monthly
$119
/month · 48-week plan
$1,428 charged upfront · saves ~30% vs monthly
Initial lab fee: $50 one-time before first prescription — drawn at Quest or Labcorp.
Gonadorelin add-on: $35/month — only if provider recommends it.
Anastrozole: Included where clinically indicated — no extra charge.
Care coaching: Not included. Optional video therapy consults at $149/session.
Eligibility

Who Qualifies — and Who Should
Discuss Carefully

Good Candidates

Men 25 and older
Confirmed low testosterone on two separate morning blood draws
Symptoms consistent with testosterone deficiency
Located in one of the 35 states where TRT will be available
No contraindications identified during provider review

Have an Honest Conversation With Your Provider If You Have

Plans to conceive — TRT suppresses sperm production
History of prostate cancer or significantly elevated PSA
History of blood clots or elevated hematocrit
Untreated sleep apnea — TRT can affect this condition
Age under 25 — natural production may still be developing

This list is informational only. Your prescribing clinician makes all eligibility determinations based on your complete health history, current medications, and lab results.

Full Transparency

Side Effects — What the
Research Shows

We believe in complete transparency. Here is what to expect and how your provider monitors for each.

Common and Manageable
Acne or oily skinMost common in weeks 1–12 as levels stabilize. Typically resolves as body adjusts.
Elevated red blood cell countMonitored via quarterly CBC. Managed with dose adjustment if needed.
Testicular size changesCommon without Gonadorelin. Reversible. Ask your provider about the add-on.
Injection site sorenessMild for 24–48 hours. Proper technique minimizes this.
Mild fluid retentionRelated to estrogen conversion. Monitored via labs.
Less Common
Estrogen elevationMonitored via labs. Managed with anastrozole if indicated.
Sleep apneaPre-existing conditions may be affected. Always disclose in intake.
Scalp hair thinningDHT-related. Ask about hair restoration if this is a concern.
Fertility Note

TRT suppresses natural sperm production. If you are planning to have children or want to preserve that option, discuss this with your provider before starting. This is one of the most important conversations to have at intake.

Side effects vary between individuals. Your provider monitors you throughout. Contact 24/7 patient support if you experience unexpected symptoms.

Stack & Save

Programs That Work
Well With TRT

Many patients combine TRT with other programs for more comprehensive results. Your provider guides what makes clinical sense for your individual situation.

Coming Soon

TRT + Sermorelin

The gold standard men’s optimization protocol. Testosterone restores hormonal baseline. Sermorelin supports natural growth hormone production simultaneously. Together they address the two primary hormonal declines in aging men.

Combined from: $169 + $149 = from $318/month
Learn about Sermorelin →
Coming Soon

TRT + NAD+

Hormone and cellular energy support. TRT restores testosterone. NAD+ restores cellular energy that declines independently of testosterone. Patients combining both often report improved mental clarity and sustained energy beyond what either provides alone.

Combined from: $169 + $149 = from $318/month
Learn about NAD+ →
Coming Soon

TRT + Hair Restoration

For men concerned about DHT-related hair loss. Managing both simultaneously is more effective than addressing hair loss after it has progressed.

Combined from: $169 + $85 = from $254/month
Hair Restoration →

Individual programs require separate provider evaluation. Combinations at provider discretion based on health history and labs.

The Process

From Assessment to First Dose
— What to Expect

1
Day 1 — Complete Your Free Health AssessmentAnswer questions about your symptoms, health history, current medications, and goals. Takes approximately 5 minutes.
2
Day 1–2 — Get Your Initial LabsProvider sends lab order electronically to Quest or Labcorp. Visit any location near you — no appointment needed at most locations. One-time $50 lab fee paid directly.
3
Day 2–4 — Provider ReviewA licensed independent physician reviews your lab results and health intake within 24–48 hours. If you qualify your prescription is written. If additional information is needed your provider reaches out via your patient portal.
4
Day 5–12 — Medication ShipsPrescription goes to our FDA-registered compounding pharmacy. Prepared and shipped discreetly within 2–3 business days of approval.
Certain states require a brief video consultation before your first prescription. Your patient portal confirms whether this applies to you.
Common Questions

TRT Questions Answered

How do I know if I have low testosterone?+
The most reliable way is a blood test measuring total and free testosterone drawn in the morning when levels are highest. Symptoms alone are not diagnostic. Our intake captures your full symptom picture and your provider orders labs before prescribing to confirm clinical need.
Is TRT available in my state?+
TRT is launching soon in 35 states. See the full state list above. If your state is not listed, Enclomiphene — our non-steroid alternative — is also coming soon in all 50 states and may be appropriate for you.
Will I have to inject myself?+
Injection is the most common and most effective delivery method and most patients find it straightforward after the first time. We also offer topical gel and oral formulations. Your provider recommends the best option.
Does TRT affect fertility?+
Yes. TRT suppresses natural sperm production. If you are currently trying to conceive or want to preserve that option, discuss this with your provider before starting. Gonadorelin can help maintain testicular function. Enclomiphene is an alternative that supports natural testosterone without suppressing fertility.
Will I need to take TRT forever?+
Not necessarily. Some patients use TRT for a defined period then transition to Enclomiphene to restore natural production. Others continue long-term. This is a decision you make with your provider over time — not a permanent commitment on day one.
What happens at quarterly check-ins?+
Every three months you get labs at Quest or Labcorp — included in your monthly price. Your provider reviews results and conducts a brief sync visit to discuss progress and any dose adjustments.
Can I cancel after joining the waitlist?+
Yes. Joining the waitlist creates no obligation. You will be notified when enrollment opens and can choose whether to proceed at that time.
Coming Soon

Be First in Line
When We Launch

Join the waitlist now. We will notify you the moment TRT enrollment opens and give waitlist members priority access.

Licensed Physicians
Labs Included
Flat Pricing
Cancel Anytime
Compounded medications are not FDA-approved finished drug products. Results may vary. Not all patients will qualify for treatment. Prescribing decisions are made solely by licensed independent clinicians based on individual medical evaluation. This is not medical advice.